Protein Info for Shewana3_2585 in Shewanella sp. ANA-3

Annotation: DNA internalization-related competence protein ComEC/Rec2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 305 to 337 (33 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details amino acids 458 to 479 (22 residues), see Phobius details amino acids 486 to 505 (20 residues), see Phobius details PF13567: DUF4131" amino acids 19 to 160 (142 residues), 52.9 bits, see alignment E=5.4e-18 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 94 to 735 (642 residues), 383.2 bits, see alignment E=2e-118 PF03772: Competence" amino acids 196 to 478 (283 residues), 181.1 bits, see alignment E=4.3e-57 TIGR00360: ComEC/Rec2-related protein" amino acids 218 to 408 (191 residues), 83 bits, see alignment E=3.1e-27 PF00753: Lactamase_B" amino acids 521 to 697 (177 residues), 55.6 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to shn:Shewana3_2585)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYE3 at UniProt or InterPro

Protein Sequence (773 amino acids)

>Shewana3_2585 DNA internalization-related competence protein ComEC/Rec2 (RefSeq) (Shewanella sp. ANA-3)
MNGFIFGFSATLLSAMLWPSLLPINSLPYLCLGALILFKKAPSLSGILFAMCWLTGFCLV
LSRQDLPLSQQPIQVRAEIISLVSQNSDWVSFDIIVDKPNLIFWPRAKLRLTWQSPEAVQ
VGQVWSFTLMPKTISSVLNQGGYNEQKQLISQHIVGKGRVLHATLETSHFSLRNHLISQL
SPKLPTFEQGDILLALILGDKQLIPASKWQALRQTGTGHLVAISGLHLSVITAWVYVCTL
FLLSRFAAHPSRRNLVIALLLAGGCALFYSYLAGFAVSTQRALVMILLIMLLSLLRRYSS
AWDRLLFALFIVLLLDPLACLSAGFWLSFCALAIILYTLESAPRIQPVEGNATFRAKARG
RLAQFWSIQWRLSLVLGLVQAVFFGGLSVHSLWMNMLVVPWFSLIVIPLSMLAFILWWVG
TLLGQAWFALFHLADLTLLPYGKLLELSGDLPAHWHSVSETLLGASLCALLALILWRYLP
HHSRYGLWHLPLALLFIPFILVIFPRVTESSSPQWTLHLLDVGQGLAVVIEQDKRALIYD
TGAAFGEDFSYSERVVIPFLNSKGLAQVDYIVVSHRDNDHAGGAEVLAKAYPRANWITDV
AHLAGMPCVPQQIQWQQLTLNFISPQTAKGGNNASCVLRIDDGAHSLLLSGDIEKETEAV
LIEQALKGAELKSQVLIAPHHGSRTSSTPAFIDAVAPELVLFPSGLNNRYGFPKPDVVAR
YQARNIQYLTTGREGQISVSFNAGRLEVKTYRRDLAPFWYNRLFRFGDLINPE