Protein Info for Shewana3_2583 in Shewanella sp. ANA-3

Name: lpxK
Annotation: tetraacyldisaccharide 4'-kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details PF02606: LpxK" amino acids 15 to 321 (307 residues), 386 bits, see alignment E=7.1e-120 TIGR00682: tetraacyldisaccharide 4'-kinase" amino acids 22 to 319 (298 residues), 283.3 bits, see alignment E=1.1e-88

Best Hits

Swiss-Prot: 100% identical to LPXK_SHESA: Tetraacyldisaccharide 4'-kinase (lpxK) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to shn:Shewana3_2583)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYE1 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Shewana3_2583 tetraacyldisaccharide 4'-kinase (RefSeq) (Shewanella sp. ANA-3)
MQALVNKIWYEGHPLRWLLLPFSVLFALITAIRRSLFRLGLKSQTALPVPVIVVGNITVG
GSGKTPTVIYLIELLRQHGFNPGVISRGYGADIQGVKVVTAVDSAAAVGDEPAMIVARTS
VPMVVGAKRVDTAKALLAEFAVDVIICDDGLQHYALGRDIELVVIDGKRGLGNRHLLPAG
PLREGAWRLNQVDFVVVNGGPAQANQFEMQLSPSAVLPVNPKAEAVFNPTQPVVAMAGIG
HPARFFETLTQQGIQLALSHGFDDHQAYDKHVLCELAASRPLMMTEKDAVKCRDFAQENW
WYLAVDAKLSPQFDQQLLSRVRSVAAAKQGKSHGV