Protein Info for Shewana3_2580 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 78 to 107 (30 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details PF01891: CbiM" amino acids 24 to 216 (193 residues), 28.7 bits, see alignment E=6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2580)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYD8 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Shewana3_2580 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MLDFWANRLAQIEWGISPLQCLSLLLLALWIYAIWPKEELQQVLKDKGLQWRLLLTLIAV
NTLWLLNASIQVGLHLHFLGIVTCLLMFGWRLATVALLLPSAFFSMFVLKQPAEFGAFSL
FAIAIPLFCAFILYSRSYHLFPKHIFVFIFVGAFINAGLSTVFHQFSWAFWLWLSMDYDW
GVLIDNYLMLIPLLAFPEALLNGMAVTLLVVYQPQWLFDYSDREYLWRK