Protein Info for Shewana3_2521 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details PF08269: dCache_2" amino acids 36 to 177 (142 residues), 77 bits, see alignment E=3e-25 PF17200: sCache_2" amino acids 40 to 179 (140 residues), 87.4 bits, see alignment E=1.9e-28 PF00672: HAMP" amino acids 202 to 252 (51 residues), 47.3 bits, see alignment 4.3e-16 PF00015: MCPsignal" amino acids 343 to 497 (155 residues), 147.4 bits, see alignment E=8e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to shn:Shewana3_2521)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KY81 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Shewana3_2521 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella sp. ANA-3)
MFKLADIPVSRKLALQLITALIGALILLTLSVTTLKSNLMAEREARLNAVLSLALSRIQA
LQQNLPLEQAQQAAKEMLNNMRFDGDNYLFVIDETRHIIVHPVKPELVSQQMGNNGAEQY
WFSMVELGRNGQQGVLQYPWVTGNGKKAQKMSLVMGFKPWGWILGSGILLQDIENTIWHE
YVLMGGTTLILILLMAALGYIISRSIVQPLDQVNNAMQIIATGNLTPQLAVTGKDELAAL
AHNINQSMASIRTALAEANHSADNVSQAASRIASTAEETNQAVNNQRDQLAQLATAMNEM
SATIADVANNAESTAKDTKEATREAGLGDKDVHASVDGIHALAKEVEQATQQVNKLKEEI
MQISEVTAVISAISDQTNLLALNAAIEAARAGEQGRGFAVVADEVRQLASRTRQSTEEIQ
NTISLLQQRAVSAANAMDTSRDLAEKSVDQSTKAGNDLSLIVTHIKHVSDMATQIATAAE
EQSAVAEEMNRNVCGINSSALEVSESATYLAQESESLAELSLNLNNKLAAFKL