Protein Info for Shewana3_2483 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 127 to 154 (28 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF05231: MASE1" amino acids 18 to 290 (273 residues), 55.7 bits, see alignment E=4.4e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 308 to 463 (156 residues), 135.9 bits, see alignment E=5.6e-44 PF00990: GGDEF" amino acids 309 to 460 (152 residues), 139.2 bits, see alignment E=1.1e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2483)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KY43 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Shewana3_2483 diguanylate cyclase (RefSeq) (Shewanella sp. ANA-3)
MKTLFSPLLPARQSHIALLCAGIIYWLTGALGQTLFSLQPENITLIWLPSGIALVMLLMW
GRKALLLIFLVSFTLNFQGMLQQDSLGLSLLHTSIAALSDMLAPAMSMLLLRRFLPQGTG
SANDLMKFVVVAGIIPIFGSSALLSANLVLGGYILPSAFWSMGQMFFFADILGIVLVYQL
YAGWVEPNALSIAKTRHILLPLIGLPLFCLVGVKFDLGWLFYVIPPLLVVLSFEVTRFYL
ALFSSASMLFMILATAQGYGPFINATPYQTNAEMMAFVLSSALTIFGVSLQRAQLRRTER
DKQTAVQEALYDPLSGLLNRRGFMPQLTNLNGQTVRYSVAMLDLDNFKMINDTYGDSVGD
RVIQLLAQLIHNHSRSQDIAARLGGEEFALVLRDIDAEQVYPVLERIRKSFAEMSIAAEE
HTIYCTVSIGWVEYQQGIAGESLLHLADKALYQAKAKGKNTIVKYQA