Protein Info for Shewana3_2471 in Shewanella sp. ANA-3

Annotation: alpha/beta fold family hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 66 to 86 (21 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 5 to 237 (233 residues), 67.8 bits, see alignment E=4.4e-22 PF00561: Abhydrolase_1" amino acids 6 to 233 (228 residues), 67.9 bits, see alignment E=2.3e-22 PF12146: Hydrolase_4" amino acids 16 to 231 (216 residues), 46.9 bits, see alignment E=4.4e-16 PF00975: Thioesterase" amino acids 18 to 158 (141 residues), 41.2 bits, see alignment E=4.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2471)

Predicted SEED Role

"FIG084569: hydrolase, alpha/beta fold family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KY31 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Shewana3_2471 alpha/beta fold family hydrolase (RefSeq) (Shewanella sp. ANA-3)
MTTWVLLRGLMRDKRHWNGFDQRLRQRGCTVFTPDLPGNGSLTHQSSPLTIAEYASSVWL
QLDEQLAGQAFYLLGLSMGGMLAMEMAKQRPEQIKHLFVLNSSAANLSPWYQRFNGLNAL
RAWLNRCRGRQLNPIESTIVRLTSYRHRRDIALIERWSRYRHESTPFFSNACRQLWAAFR
YCCPASLPVPVSILSGDRDALVNIQTSRALAQQFKVELVVLAYCGHDITIDAPAKLAHYL
FEIISLEQGDGSASFADCGDLLDEETAFHEARLVQSLPNYLSALPTDVE