Protein Info for Shewana3_2469 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: K01505, 1-aminocyclopropane-1-carboxylate deaminase [EC: 3.5.99.7] (inferred from 100% identity to shn:Shewana3_2469)

Predicted SEED Role

"pyridoxal phosphate-dependent deaminase, putative"

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• L-methionine degradation II (3/3 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.7

Sequence Analysis Tools

See A0KY29 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Shewana3_2469 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MESFSFAGREIFLKRDDLLHPAFSGNKARKFAYFLDHEFTGVTKLIGHGSAQANSLYSLS
ALTKLKGWQCDFYVDHIASHVRTLPTGNYAAAIANGTRVINLSSLIAANPSLHREPNRTC
QDYIEQQVLPAEPKALFIPEGGRCQYAQYGVSQLAAEIAAWAESQHISELKVFLPAGTGT
TALFLNQYFVRQQLNIRVLTCAVVGGDEYLTQQFYELNPDSAEHPQILNVGKKYHFGKLY
PEFYAMWQRLCASGVQFELLYDPLGFIVLEDYLRREQHASILYIHQGGLLGNQTMLPRYR
RKYGEGDKESV