Protein Info for Shewana3_2463 in Shewanella sp. ANA-3

Annotation: methyltransferase type 11 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF01209: Ubie_methyltran" amino acids 41 to 148 (108 residues), 39.5 bits, see alignment E=1.3e-13 PF13489: Methyltransf_23" amino acids 41 to 165 (125 residues), 59.8 bits, see alignment E=8.6e-20 PF13847: Methyltransf_31" amino acids 42 to 165 (124 residues), 70.2 bits, see alignment E=5.3e-23 PF08241: Methyltransf_11" amino acids 43 to 143 (101 residues), 95.7 bits, see alignment E=6.6e-31 PF08242: Methyltransf_12" amino acids 43 to 141 (99 residues), 71.1 bits, see alignment E=3.3e-23 PF13649: Methyltransf_25" amino acids 43 to 139 (97 residues), 86.6 bits, see alignment E=4.8e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2463)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KY23 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Shewana3_2463 methyltransferase type 11 (RefSeq) (Shewanella sp. ANA-3)
MKLNPFEKKLVQHPLRFWLQNHIEAPLLTSMMPKPLPYIRHALEIGCGFGNGIQLIRDHF
GAEQVTAVDLDPEMVAPAKARWHDSPNGLSQLAFSVADATALPFANAQFDVVFNFAVFHH
IPDWQAAVAEVARVLKPNGYFVVEDLYRAAICNPLSRRLFEHPQQNRFNHQEWLAGLRQG
GFEIRCERNLLNLSGMVLAQKRMG