Protein Info for Shewana3_2438 in Shewanella sp. ANA-3

Name: nadE
Annotation: NAD synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF02540: NAD_synthase" amino acids 41 to 290 (250 residues), 210.7 bits, see alignment E=9.4e-67 TIGR00552: NAD+ synthetase" amino acids 42 to 292 (251 residues), 217.7 bits, see alignment E=7.7e-69

Best Hits

Swiss-Prot: 92% identical to NADE_SHEON: NH(3)-dependent NAD(+) synthetase (nadE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 100% identity to shn:Shewana3_2438)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXZ8 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Shewana3_2438 NAD synthetase (RefSeq) (Shewanella sp. ANA-3)
MITLAQSLLPITANIKVEFSVKAQILTEMKVLKTIDPEFEVQRRVAFIKSKLQAARSKAL
VLGISGGVDSSTAGRLCQLAVDSLNSEHTDGGYQFIAVRLPYQIQKDEHEAQQACQFIQP
TKLVTINVHQGVDGVHQATLTAFVEAGLHSPDAAKVDFIKGNVKARMRMIAQYELAGLVG
GLVVGTDHSAENITGFYTKWGDGACDLAPLFGLNKRQVRQVAAYLGAPESLVYKAPTADL
EDNQPLLEDEVALGLTYEQIDDFLEGKEVGKDVEEKLINIYKATQHKRQPIPTIYD