Protein Info for Shewana3_2425 in Shewanella sp. ANA-3

Annotation: di-haem cytochrome c peroxidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03150: CCP_MauG" amino acids 37 to 185 (149 residues), 189.5 bits, see alignment E=5.4e-60 PF00034: Cytochrom_C" amino acids 192 to 303 (112 residues), 27.8 bits, see alignment E=5.2e-10

Best Hits

Swiss-Prot: 62% identical to CCPR_NITEU: Cytochrome c551 peroxidase (ccp) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K00428, cytochrome c peroxidase [EC: 1.11.1.5] (inferred from 100% identity to shn:Shewana3_2425)

MetaCyc: 48% identical to cytochrome c peroxidase (Pseudomonas aeruginosa)
Cytochrome-c peroxidase. [EC: 1.11.1.5]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXY5 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Shewana3_2425 di-haem cytochrome c peroxidase (RefSeq) (Shewanella sp. ANA-3)
MIKLTAIAISIMAMLGGHYAVAAEPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISC
NSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASDLKEQAAGPIAN
PKEMGFTHELATETIASMPAYRARFAKVYGDDKVDIDRLTDAIAAFEKTLVTPNSPFDQY
LLGKQDAISSEAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVT
GKEADKYVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTDKETKEMVSFL
NSLTGEQPQITLPILPPSNKATPRPVPFAAATK