Protein Info for Shewana3_2417 in Shewanella sp. ANA-3

Annotation: polyphosphate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 TIGR03705: polyphosphate kinase 1" amino acids 10 to 679 (670 residues), 836.4 bits, see alignment E=9.4e-256 PF13089: PP_kinase_N" amino acids 10 to 111 (102 residues), 102.3 bits, see alignment E=4.8e-33 PF02503: PP_kinase" amino acids 122 to 305 (184 residues), 157.6 bits, see alignment E=6.9e-50 PF17941: PP_kinase_C_1" amino acids 332 to 495 (164 residues), 224.3 bits, see alignment E=1.7e-70 PF13091: PLDc_2" amino acids 366 to 489 (124 residues), 36 bits, see alignment E=1.4e-12 PF13090: PP_kinase_C" amino acids 503 to 674 (172 residues), 222.6 bits, see alignment E=5.9e-70

Best Hits

Swiss-Prot: 56% identical to PPK1_VIBCH: Polyphosphate kinase (ppk) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00937, polyphosphate kinase [EC: 2.7.4.1] (inferred from 100% identity to shn:Shewana3_2417)

MetaCyc: 53% identical to polyphosphate kinase (Escherichia coli K-12 substr. MG1655)
Polyphosphate kinase. [EC: 2.7.4.1]

Predicted SEED Role

"Polyphosphate kinase (EC 2.7.4.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism or Purine conversions (EC 2.7.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXX7 at UniProt or InterPro

Protein Sequence (720 amino acids)

>Shewana3_2417 polyphosphate kinase (RefSeq) (Shewanella sp. ANA-3)
MSPNTDKLSIDKEISWLSFNERVLQEACDPNVPIVERVRFLGIFSNNMDEFFRVRVAAVR
RSILLSALQEGRSNSRHLMAKIQTKVMALQERFDSIYVELMRELVRRNILLINEKQLSEF
HSNWLKKHFRDHFKRHIAPLIVNNNRDLVKHINDDATYLCVCLFTKSRRQYALVEVPTKN
VPRFIELPAEKSKAKKYLILLDNIIRHCVDDLFGPFFEYDAIEVYSMKLTRDAEFDITDE
LEQTQLEKMTKGLKKRLTAEPVRLVYDKEMPEHMLEMLKENLNISSTECLIPGGRYHSFK
DFIGFPNPSRDYLENEKLPALNSSGFGRSANSFDAIKMGDIMVNYPYHKFSHFTEMVRQA
AYDPAVRFIRINLYRVAKKSHVMQSLIDAVKNGKQVTAVIELRARFDEQSNIEWTRVLAE
AGVKVHHGITSLKVHSKLCLIGREEQGEMKLYCHVGSGNFNEGTARVYTDLSLFTANQEI
AREVEQVFDLIEHPYRRDNFQHLIVSPYDARQKLTHLIDNEIVNAQSHIKAAITLKLNNL
LDESLVQKLYEASAAGVKIKLLIRGMCSLIPQIPGISDNIEIYSIVDRFLEHSRVMLFHA
GGENKLFISSADWMSRNIDNRVEVSVPIYDPRLKQMVMDILSLQFNDNTKARIINKEQSN
PYRNRGNKRKVRSQIAIYQYLINYEKRLQQEFSTQREAAKLEAEHAAELAHNLELQAKAS