Protein Info for Shewana3_2395 in Shewanella sp. ANA-3
Name: rbgA
Annotation: ribosomal biogenesis GTPase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to RBGA_GEOSW: Ribosome biogenesis GTPase A (rbgA) from Geobacillus sp. (strain WCH70)
KEGG orthology group: K14540, ribosome biogenesis GTPase A (inferred from 100% identity to she:Shewmr4_2186)Predicted SEED Role
"50S ribosomal subunit maturation GTPase RbgA (B. subtilis YlqF)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Universal GTPases
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KXV5 at UniProt or InterPro
Protein Sequence (313 amino acids)
>Shewana3_2395 ribosomal biogenesis GTPase (RefSeq) (Shewanella sp. ANA-3) MAIQWYPGHMHKARKEIEEAMPQVDLVIEVLDARIPYSSENPMVSKLRGDKPCIKLLNKS DLADPEITAQWIEYLEREQGVKATAITTLQPGMLKMLPDLCRKLVPSRDKTEKDIRTMIM GIPNVGKSTIINTLAGRVIAKTGNEPAVTKSQQRINLRNGIVLSDTPGILWPKVDNEASS YRLAVTGAIKDTAMEYEDVALFAAGYFLKAYPKEICERYNISELPKDDMALLEEIGRKRG ALRPGGRIDLHKASEVVLHDYRSGRIGLLSLETPAMAEIEKAEVERILAEKAAEKAAKLE AEKLKRSGKRHNV