Protein Info for Shewana3_2383 in Shewanella sp. ANA-3

Annotation: septum site-determining protein MinD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR01968: septum site-determining protein MinD" amino acids 2 to 267 (266 residues), 367.1 bits, see alignment E=2.4e-114 PF10609: ParA" amino acids 2 to 243 (242 residues), 54.7 bits, see alignment E=3.1e-18 PF13614: AAA_31" amino acids 3 to 161 (159 residues), 69.8 bits, see alignment E=8.4e-23 PF09140: MipZ" amino acids 4 to 143 (140 residues), 40.8 bits, see alignment E=4.9e-14 PF06564: CBP_BcsQ" amino acids 4 to 148 (145 residues), 22.9 bits, see alignment E=1.8e-08 PF01656: CbiA" amino acids 5 to 226 (222 residues), 68.7 bits, see alignment E=1.4e-22 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 35.2 bits, see alignment 2.6e-12

Best Hits

Swiss-Prot: 79% identical to MIND_ECO57: Septum site-determining protein MinD (minD) from Escherichia coli O157:H7

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 98% identity to shw:Sputw3181_2261)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXU3 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Shewana3_2383 septum site-determining protein MinD (RefSeq) (Shewanella sp. ANA-3)
MAQIIVVTSGKGGVGKTTSSAAIATGLAIQGHKTVVIDFDIGLRNLDLIMGCERRVVYDF
VNVINGEANLNQALIKDKRCEKLFVLPASQTRDKDALTKEGVGRVLDDLAKEFDFIICDS
PAGIEQGAMMALYFADIAIVTTNPEVSSVRDSDRILGMLQSKSRRAELNLEPIKEYLLLT
RYSPSRVKSGEMLSVDDVKEILAIELLGVIPESQSVLKASNSGVPVIIDQESDAGAAYSD
TVARLLGEDVPVRFITEEKKGFLQRIFGS