Protein Info for Shewana3_2348 in Shewanella sp. ANA-3

Annotation: cytochrome c biogenesis protein, transmembrane region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details PF02683: DsbD_TM" amino acids 5 to 193 (189 residues), 34.3 bits, see alignment E=1.6e-12 PF13386: DsbD_2" amino acids 11 to 220 (210 residues), 65.3 bits, see alignment E=7.2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to spc:Sputcn32_3833)

MetaCyc: 95% identical to 3-amino-4-hydroxyphenylarsenite permease (Shewanella putrefaciens 200)
RXN-22355; RXN-22357

Predicted SEED Role

"Cytochrome c biogenesis protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXQ8 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Shewana3_2348 cytochrome c biogenesis protein, transmembrane region (RefSeq) (Shewanella sp. ANA-3)
MDEWAVMLLSAFWFGILTSISPCPLATNVAAISYISKGIQSPYRVVGTGLAYTIGRMLSY
LVIGVILVGSLLSTMTLSVALQKYMNLLLGPILILVGMFLLELLTLRLPGDGALIEKLKS
KINPQGYVGALLLGVLFALSFCPTSAALFFGSLLPLALESQSSIALPAIYGLATGLPVLV
FAILLGVSAHRVAKAYNHILTFEHWARKITGVVFIIIGAYYAWVNIFVPSLF