Protein Info for Shewana3_2344 in Shewanella sp. ANA-3

Annotation: arsenical pump membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 25 to 28 (4 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 145 (30 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 374 to 391 (18 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details TIGR00935: arsenite/antimonite efflux pump membrane protein" amino acids 2 to 426 (425 residues), 759.2 bits, see alignment E=7.4e-233 PF02040: ArsB" amino acids 3 to 423 (421 residues), 523.8 bits, see alignment E=4.7e-161 PF03600: CitMHS" amino acids 12 to 368 (357 residues), 206.1 bits, see alignment E=8e-65

Best Hits

Swiss-Prot: 87% identical to ARSB2_ECOLX: Arsenical pump membrane protein (arsB) from Escherichia coli

KEGG orthology group: K03893, arsenical pump membrane protein (inferred from 100% identity to spc:Sputcn32_3829)

MetaCyc: 100% identical to arsenical pump membrane protein (Shewanella sp. ANA-3)
RXN-22366 [EC: 7.3.2.7]

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXQ4 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Shewana3_2344 arsenical pump membrane protein (RefSeq) (Shewanella sp. ANA-3)
MWLAGAIFVLTIVLVIWQPKGLGIGWSATLGAVLALLLGVVQLGDIPVVWNIVWNATATF
IAVIIISLLLDESGFFEWAALHVARWGKGRGRLLFTYIVLLGATVAALFANDGAALILTP
IVIAMLLALGFSAGATLAFVMAAGFIADTASLPLIVSNLVNIVSADFFKIGFNEYAAVMV
PVDIAAISATLVMLHVFFRKDIPATYDLEKLREPKAAIRDLNTFKTGWGVLVLLLVGFFG
LEPLGVPVSLVAAVGALILFVVAKKGHGIDTTKVLRGAPWQIVIFSLGMYLVVYGLRNAG
LTDYLSHVLDSLAAQGLWVATMGTGFLVAFLSSIMNNMPTVLVGALSIDGSNATGVIKVA
MIYANVIGSDLGPKITPIGSLATLLWLHVLAQKNINITWGYYFRVGIVMTVPVLFVTLAA
LALRLSF