Protein Info for Shewana3_2340 in Shewanella sp. ANA-3

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF12800: Fer4_4" amino acids 10 to 24 (15 residues), 10.9 bits, see alignment (E = 0.00035) amino acids 87 to 102 (16 residues), 23.6 bits, see alignment (E = 2.7e-08) PF13247: Fer4_11" amino acids 48 to 110 (63 residues), 48.7 bits, see alignment E=4.4e-16 amino acids 159 to 192 (34 residues), 29.5 bits, see alignment 4.3e-10 PF13237: Fer4_10" amino acids 52 to 100 (49 residues), 24.9 bits, see alignment 9.5e-09 amino acids 84 to 184 (101 residues), 26.8 bits, see alignment E=2.4e-09 PF13187: Fer4_9" amino acids 57 to 104 (48 residues), 31.6 bits, see alignment 8.5e-11 PF25160: LdpA_Fe-S-bd" amino acids 62 to 105 (44 residues), 31.6 bits, see alignment 6.9e-11 PF00037: Fer4" amino acids 85 to 105 (21 residues), 29.8 bits, see alignment (E = 2.2e-10) PF12798: Fer4_3" amino acids 89 to 102 (14 residues), 15.9 bits, see alignment (E = 1.2e-05) PF12838: Fer4_7" amino acids 89 to 187 (99 residues), 32.4 bits, see alignment E=6.1e-11

Best Hits

KEGG orthology group: K00184, molybdopterin oxidoreductase, iron-sulfur binding subunit [EC: 1.2.7.-] (inferred from 100% identity to spc:Sputcn32_3825)

MetaCyc: 100% identical to respiratory arsenate reductase small subunit (Shewanella sp. ANA-3)
Arsenate reductase (donor). [EC: 1.20.99.1]

Predicted SEED Role

"Respiratory arsentate reductase, FeS subunit (ArrB)"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.-

Use Curated BLAST to search for 1.2.7.- or 1.20.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7WTT9 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Shewana3_2340 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MRLGMVIDLQKCVGCGGCSLACKTENNTNDGIHWSHHIATTEGTFPDVKYTYIPTLCNHC
DDAPCVKVCPTGAMHKDKRGLTLQNNDECIGCKKCMNACPYGVISFNAATPHRRWQDDSE
VVANGTVSPLMLLKRTGATATPNENPERGDTYPMIRPKRTTEKCTFCDHRLDKGLNPACV
DACPSEARVIGDLDDPQSKVSQLIKLHKPMQLKPEAGTGPRVFYIRSFGVKTAY