Protein Info for Shewana3_2333 in Shewanella sp. ANA-3

Annotation: permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 104 to 130 (27 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details PF03773: ArsP_1" amino acids 25 to 326 (302 residues), 225.2 bits, see alignment E=5.1e-71

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to spc:Sputcn32_3818)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXP3 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Shewana3_2333 permease (RefSeq) (Shewanella sp. ANA-3)
MLQLFSDLASWLTFGVMGLDPNTKLADAVHFFIEDTTKIFALLLLMIYAIALVRASLNVE
RVRDYLAGKNRFIGYFMGSGFGAVTPFCSCSSIPVFLGFTSAGIPVGITMAFLITSPLIN
EVAVLLLVSLLGWKFTVIYVLVGMSVGILAGAFLDTIRAERWLQSFAAKALEQGQAQASQ
DNSEDMTSTSMTFTERHEFAKGETLEIFGRVWKWVIIGVGLGAALHGFVPDGWIEAHLGD
GQWWSVPAAVLIGIPLYSNATGVIPIMESLITNGLPIGTTLAFCMATVAASFPEFILLKQ
VMQWRLLAIVFAILLIAFTLIGWIFNAISPML