Protein Info for Shewana3_2331 in Shewanella sp. ANA-3

Annotation: protein tyrosine phosphatase, catalytic region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 120 to 138 (19 residues), see Phobius details PF05706: CDKN3" amino acids 32 to 135 (104 residues), 37.1 bits, see alignment E=2.6e-13 PF13350: Y_phosphatase3" amino acids 96 to 137 (42 residues), 25.6 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to spc:Sputcn32_3816)

Predicted SEED Role

"Predicted protein-tyrosine phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXP1 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Shewana3_2331 protein tyrosine phosphatase, catalytic region (RefSeq) (Shewanella sp. ANA-3)
MSHPFDILSLDSGTRLIFTPCPGTKSAPVAEAVATLKAAGTEVIITLMPLGELHTFGATS
LPDICRETGIRWLHLPIEDDASPAEEFELAFAKHRAELLALMQNKATIAIHCRGGSGRTG
LMAAILLLLAGGSLSEVITQVQSIRPNALTNAHQRSYIDQLTL