Protein Info for Shewana3_2329 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 88 to 116 (29 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 322 to 346 (25 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 279 (253 residues), 56.5 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2329)

MetaCyc: 76% identical to 1-arseno-3-phosphoglycerate exporter (Pseudomonas aeruginosa)
TRANS-RXN1YI0-17

Predicted SEED Role

"Permease of the major facilitator superfamily"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXN9 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Shewana3_2329 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MAKLTGLLSNLSPDIRQYLMITGNYWAFTLTDGALRMLVVLHFHGLGYSPLQIAMLFLFY
EIFGVVTNLVGGWLGARLGLNKTMNVGLFMQIVALSMLLVPSGMLTVAWVMAAQALSGIA
KDLNKMSAKSSIKLLVPNDAQGELYKWVAMLTGSKNALKGAGFFLGGALLTLFGFQQAVL
GMAIGLLLVWIFSLLSLQRDLGKAKNKPKFTEIFSKSSAVNTLSAARMFLFGARDVWFVV
ALPVYLASAFGWDHWYVGGFLALWVIGYGIVQGFAPRLTGTKSASQNKVPDGRSALGWAA
ILSIVPAGIALAISYDFHAANILIWGLMLFGALFAINSSLHSYLIVSYADEDGVSLDVGF
YYMANAMGRLIGTVLSGWVYQVYGMAACLWISAAFIALAALISIKLPRHRAI