Protein Info for Shewana3_2303 in Shewanella sp. ANA-3

Annotation: aminodeoxychorismate synthase, subunit I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF04715: Anth_synt_I_N" amino acids 21 to 161 (141 residues), 78.9 bits, see alignment E=4.7e-26 TIGR00553: aminodeoxychorismate synthase, component I" amino acids 114 to 457 (344 residues), 397.8 bits, see alignment E=1.8e-123 PF00425: Chorismate_bind" amino acids 202 to 455 (254 residues), 304 bits, see alignment E=9.9e-95

Best Hits

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 100% identity to shn:Shewana3_2303)

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXL3 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Shewana3_2303 aminodeoxychorismate synthase, subunit I (RefSeq) (Shewanella sp. ANA-3)
MANRAALPLAVRQLDWTFSTAAIFEYFAAEPWAILLDSANAPHQDAKFDMICAGPIATLI
TQGELTDIQVHQPELTKPTHLCPQDDPFTLVKQLLRHWYPHSFACDLPFSGGAMGSFSYD
LGRRIEQLPSTAAHDIHLGEMNIGFYDWALIFDYQQQSWFMVHYLGDAVLDTQLKIIEAK
IAKPTKQAEFRLTSPWSAQTTKAQYAAKFTQVQAYLHSGDCYQINLTQRFEAEYQGDEWR
AYCKLRSANQAPFSAFMRLDANAILSISPERFIQLRGDDIQTKPIKGTLPRHSDPMLDKQ
AAQALAHSPKDRAENVMIVDLLRNDIGKVAAPGTVQVPHLFAVESFPAVHHLVSTVTAKL
DPHYHACDLLRAAFPGGSITGAPKIRAMEIIEELEPSRRSLYCGSMGYISQDGQMDTSIT
IRTIVAEQGKLYCWAGGGIVADSNVDAEYQESFDKISRILPLLDSPQ