Protein Info for Shewana3_2276 in Shewanella sp. ANA-3

Name: hscA
Annotation: chaperone protein HscA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 TIGR01991: Fe-S protein assembly chaperone HscA" amino acids 21 to 619 (599 residues), 883.6 bits, see alignment E=3.4e-270 PF00012: HSP70" amino acids 21 to 604 (584 residues), 630.8 bits, see alignment E=2.1e-193 PF06723: MreB_Mbl" amino acids 121 to 377 (257 residues), 57.6 bits, see alignment E=1e-19

Best Hits

Swiss-Prot: 100% identical to HSCA_SHESA: Chaperone protein HscA homolog (hscA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K04044, molecular chaperone HscA (inferred from 100% identity to shn:Shewana3_2276)

Predicted SEED Role

"Chaperone protein HscA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXI6 at UniProt or InterPro

Protein Sequence (620 amino acids)

>Shewana3_2276 chaperone protein HscA (RefSeq) (Shewanella sp. ANA-3)
MALLQIAEPGQSAAPHQHRLAVGIDLGTTNSLVAAVRSGVTATLPDENGQHSLPSIVRYT
QDGIEVGQVAALSSAQDPKNTIVSVKRFMGRSLTDIQSGEQAFPYQFEASENGLPLFVTP
QGQVNPVQVSAEILRPLVERAEKTLGGELQGVVITVPAYFDDAQRQGTKDAASLLGVKVL
RLLNEPTAAAIAYGLDSKQEGVIAIYDLGGGTFDISILRLNRGVFEVLATGGDSALGGDD
FDHLLQAHMQQVWQLANIDSQLSRQLLIEARRVKEALTDASEVEASLTLADGTVLKQLVT
KAEFDCLISALVKKTIASCRRTLRDAGVTADEVLETVMVGGSTRVPLVREQVEAFFGKAP
LTSIDPDRVVAIGAAIQADILVGNKPESELLLLDVIPLSLGIETMGGLVEKVVSRNTTIP
VARAQEFTTFKDGQTAMAFHVVQGERELVDDCRSLARFTLKGIPPLAAGAAHIRVTFQVD
ADGLLSVTAMEKSTGVQSSIQVKPSFGLSDTEIATMLKDSMKHAKEDISRRMLAEQQVEA
ARVLESLNAALAKDGDLLTSDERQQIDAVMAQLAEIARGDDADAIKQAIEVLDEHTQDFA
AKRMDNSIRVAFKGQSIDNI