Protein Info for Shewana3_2256 in Shewanella sp. ANA-3
Annotation: HPr family phosphocarrier protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to PTHP_VIBCH: Phosphocarrier protein HPr (ptsH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K02784, phosphocarrier protein HPr (inferred from 99% identity to shm:Shewmr7_1843)MetaCyc: 58% identical to phosphocarrier protein HPr (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Phosphocarrier protein of PTS system" in subsystem Fructose and Mannose Inducible PTS or Mannitol Utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KXG6 at UniProt or InterPro
Protein Sequence (85 amino acids)
>Shewana3_2256 HPr family phosphocarrier protein (RefSeq) (Shewanella sp. ANA-3) MYEKSVTITAKHGIHTRPAALLVKEAKTFNCDVLVECNGKQASAKSLFKLQTLGLYHGVT VKVFAEGEQAQEAVEKVSELLITLS