Protein Info for Shewana3_2256 in Shewanella sp. ANA-3

Annotation: HPr family phosphocarrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 TIGR01003: phosphocarrier, HPr family" amino acids 1 to 81 (81 residues), 89.3 bits, see alignment E=6.3e-30 PF00381: PTS-HPr" amino acids 3 to 81 (79 residues), 91.4 bits, see alignment E=1.6e-30

Best Hits

Swiss-Prot: 64% identical to PTHP_VIBCH: Phosphocarrier protein HPr (ptsH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02784, phosphocarrier protein HPr (inferred from 99% identity to shm:Shewmr7_1843)

MetaCyc: 58% identical to phosphocarrier protein HPr (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphocarrier protein of PTS system" in subsystem Fructose and Mannose Inducible PTS or Mannitol Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXG6 at UniProt or InterPro

Protein Sequence (85 amino acids)

>Shewana3_2256 HPr family phosphocarrier protein (RefSeq) (Shewanella sp. ANA-3)
MYEKSVTITAKHGIHTRPAALLVKEAKTFNCDVLVECNGKQASAKSLFKLQTLGLYHGVT
VKVFAEGEQAQEAVEKVSELLITLS