Protein Info for Shewana3_2254 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details PF08269: dCache_2" amino acids 32 to 195 (164 residues), 83.8 bits, see alignment E=3.2e-27 PF17200: sCache_2" amino acids 40 to 189 (150 residues), 127 bits, see alignment E=1.6e-40 PF17201: Cache_3-Cache_2" amino acids 73 to 190 (118 residues), 32.3 bits, see alignment E=1.7e-11 PF00672: HAMP" amino acids 212 to 263 (52 residues), 42 bits, see alignment 2.4e-14 PF00015: MCPsignal" amino acids 327 to 511 (185 residues), 154 bits, see alignment E=9.1e-49

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to shn:Shewana3_2254)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXG4 at UniProt or InterPro

Protein Sequence (545 amino acids)

>Shewana3_2254 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella sp. ANA-3)
MITFLRRFTILQRLMMMLVMAAIGTVCFASFSIKEQYSNLIEQKWQQIDGQLGSLLSVID
IHRQDALSGKLSEAEAQQAAANLIDQTRYAGVGYFIVIDDNNQILAHGERSDLIGTSALN
FKLQNGTNPLATMLPLARQNGKTMLEYPIANPVSKNIEDKLVEARYYPEWGWTLITGAYL
SDVKQSLKAVIIDYLIIMFLISVPIFAFFLVLNHSITSPLNDAIDALEDIAQGEGDLSQR
LSTQGKDEVAHLAHAFNLFAQKIGDMVGHLQPLGQSLDNDAKQLMLAVEESNQSAEHIHR
ETGSVATAVNQMLSTTHEMASNTQQAADAANSVKNQAQQSQAVIDDTVRDTEKLVQELRA
SEVITQKLGQSSAQIGSILDVIRSIAEQTNLLALNAAIEAARAGSHGRGFAVVADEVRAL
ANRTQDSTNEIQKIISDIQMGVNSVMKSNSQTQTQSDELQAKAREAGNAMAAILQLIAHI
SDMNTQLASATEEQSLVTEEINRNICNISELTEVSVKANEGNSRAAQSLQDISQDMSHTL
GQFKI