Protein Info for Shewana3_2250 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR00229: PAS domain S-box protein" amino acids 38 to 140 (103 residues), 35.4 bits, see alignment E=5.4e-13 amino acids 155 to 265 (111 residues), 35.3 bits, see alignment E=5.6e-13 PF08448: PAS_4" amino acids 40 to 141 (102 residues), 42.7 bits, see alignment E=1.5e-14 amino acids 159 to 262 (104 residues), 31.7 bits, see alignment E=3.8e-11 PF13426: PAS_9" amino acids 40 to 140 (101 residues), 54.3 bits, see alignment E=3.5e-18 amino acids 165 to 259 (95 residues), 36.7 bits, see alignment E=1.1e-12 PF08447: PAS_3" amino acids 48 to 134 (87 residues), 45.4 bits, see alignment E=2e-15 amino acids 171 to 254 (84 residues), 49.9 bits, see alignment E=8.1e-17 PF00015: MCPsignal" amino acids 293 to 432 (140 residues), 109.1 bits, see alignment E=5.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2250)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXG0 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Shewana3_2250 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq) (Shewanella sp. ANA-3)
MFWWKVKSNNRDANNHSSGFTAAETLENELAAIRAYTAYICFTPKGEIIEANDIFLDVMG
YSANEILGKHHRMFCTAQYSGSQEYQKFWQELAAGNAFTGTFQRLKKNHIPVYVEASYFP
VKNSAGDVVKIIKIANDVTASQLNLIAKNAILDALDRSQAVIEFLPDGTVITANQNFLDI
MHYRLDEIQGKHHKMFCDKEFYRIRPDFWKRLAAGEHFTGRFKRIDAHNNVIWLEATYNP
IWDASNKVYKIVKFASDISHRVNTALQAVDMAAATSEQTSQITTNAVQVLNEAVCTSHQI
AEQVKNASNIGGELLVQSKNINDIVITIRGIAEQTNLLALNAAIEAARAGDLGRGFAVVA
DEVRKLASRTSTATSEIANVVQQNTDLIKNIDHQLSNITNVALHGEDSINHVAAGLADVG
NGVSQFVAMVEQLRP