Protein Info for Shewana3_2244 in Shewanella sp. ANA-3

Annotation: transglutaminase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 715 transmembrane" amino acids 34 to 50 (17 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 592 to 614 (23 residues), see Phobius details PF11992: TgpA_N" amino acids 37 to 368 (332 residues), 226 bits, see alignment E=9.5e-71 PF01841: Transglut_core" amino acids 396 to 510 (115 residues), 86 bits, see alignment E=3.3e-28 PF13559: DUF4129" amino acids 627 to 694 (68 residues), 27.1 bits, see alignment E=5.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2244)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXF4 at UniProt or InterPro

Protein Sequence (715 amino acids)

>Shewana3_2244 transglutaminase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MTTQASTHHKANPHKLTTYHANGPQTGDNISRQTLFWLLLTNIAVLSPLFDKTTPWTLGI
CAICLVWRVGIYVGKVAKPPRYLVTSLAIGAAVTLALVSGEIGLLNALVNLLILGYALKY
IEMRSVRDVRAVVIVGYFLIALTFIDHQSMLNTVHLIGVTIINTCVLVTLYQSKHNWQHT
AWIGAKLLLQSVPLALLLFLVLPRFAPLWLVPNMKEAQTGLSDTLSVSDISKLTRSSALA
FRVSFTEARPIQAELYWRALVLEDYDGQTWRQDVGIKQIQKDALFFPPSRPDPARQLPAA
MTDDTGSHAPQRYDYQVIVEPSHQPWLFGLDVAYSQDEKVINLPDYRLYSLRNVDQRMGY
SARSWPKAQMDLKLTAKQRQINQKLPEDTNPKTLALATEFKANYPEPKQRLLAMMGYFNR
EPFFYTLTPPPIGPQQVDDFLFENKAGFCAHYASAFIFMARATGLPARMVTGYQGGEYNP
QADYLSVYQYMAHAWAEVWLENEGWVRFDPTAMVAPNRIEQGFDAEFSPEQSYLQESPFS
SLRFKTMPWLNELRQRFASLDYYWSLWVLGFNQERQNKVLSGILGDVTKTKVAVFMSVCI
SLIGLYIAYSVGLFRFKREQDPISAKYQRICQRLSKFGIVRPAHLGPNAFAEQLIDTHQQ
QSPEFCREFDTLTQSYVALKYQQLADGDYQAALKRFNNAAKSLNWRLFGPSKQLK