Protein Info for Shewana3_2242 in Shewanella sp. ANA-3

Annotation: ATPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF20030: bpMoxR" amino acids 16 to 193 (178 residues), 32.7 bits, see alignment E=1.2e-11 PF07726: AAA_3" amino acids 46 to 176 (131 residues), 211.6 bits, see alignment E=9.3e-67 PF00493: MCM" amino acids 46 to 159 (114 residues), 24.4 bits, see alignment E=4.3e-09 PF00004: AAA" amino acids 53 to 179 (127 residues), 24.5 bits, see alignment E=9.7e-09 PF07728: AAA_5" amino acids 53 to 174 (122 residues), 44.4 bits, see alignment E=5.2e-15 PF17863: AAA_lid_2" amino acids 246 to 298 (53 residues), 62 bits, see alignment 1.1e-20

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to shn:Shewana3_2242)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXF2 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Shewana3_2242 ATPase (RefSeq) (Shewanella sp. ANA-3)
MTLSMHKESPVAHSGLSQLLQQLEQVLLGKPRQIRLALACILARGHLLIEDLPGMGKTSL
SHALAQSLGLSYQRIQFTSDMLPADILGVSIFDKHQAQFVFHPGPIFKQMVLADEINRAS
PKTQSALLEAMAEQQISVDGITHRLPNPFFVIATQNPTEQSGTFPLPESQLDRFMMRISI
GYPSHDAELAMLKSDQTPQTLDNLPQCLTPLALTQLQEQCDKVAASDALLNYVLALVHDS
RNQTDAVGLSPRATKALLQAAKAWAFLEGRHYLVPEDVQAVFCSVAEHRLRTSSQLQGEA
LSERILASVNPIM