Protein Info for Shewana3_2220 in Shewanella sp. ANA-3

Annotation: response regulator receiver protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 301 to 320 (20 residues), see Phobius details amino acids 341 to 357 (17 residues), see Phobius details PF00072: Response_reg" amino acids 8 to 115 (108 residues), 62 bits, see alignment E=8.5e-21 PF07228: SpoIIE" amino acids 191 to 387 (197 residues), 110.6 bits, see alignment E=1.5e-35 PF13581: HATPase_c_2" amino acids 430 to 563 (134 residues), 32 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2220)

Predicted SEED Role

"Che cluster related two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXD0 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Shewana3_2220 response regulator receiver protein (RefSeq) (Shewanella sp. ANA-3)
MPKSQRYILVIEDDLVTNQIITAFIHSKGWGVITCCSLEEASEEIYQQNIELILLDYFLP
DGSALTLLEKLRYCESPVPVIVISADNEYQKILSCFRLGALDYIIKPINLELFWHKVEGL
LAHFSLEKQVKQQRSILEKMLYQKAREEQMARHLFEHLVNIGNVTYDFVKTFTQASANFS
GDIILNTVGPNGNFFLIIADSTGHGLSAAMPILRVANTFRAMVAKGFNLVSLIYELNANV
YEDSPGDRFVAAMVLEVDFFKNQIHLWNGGMPDALLYQDEFEGSTGHSELDHIQRYRSKN
MALGILSPSSFIANIATFPIPKTGRICLLSDGLIEQQSKGGVFFGMDSVISLLSFYGRDL
TEHLKAKLKSIFEHEITDDIAVCVLDFELLNNWYREREHKSSQICMKGEFAWAIKMMGSM
LLNVDYLNSLNQFLNIFGFSTTFSQRVFTVVSELVTNAVDHGVLKLDSRLKNDPESFELY
HSIREGSIDKLIASDWVKVELEWHAQLNELKIIVSDSGEGYIPKEQAASTDWFQISGRGL
LLVKSLCKSYELVAPGNKTKVIMEL