Protein Info for Shewana3_2212 in Shewanella sp. ANA-3

Annotation: response regulator receiver modulated diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 PF01627: Hpt" amino acids 10 to 98 (89 residues), 32 bits, see alignment E=1.8e-11 PF00072: Response_reg" amino acids 132 to 242 (111 residues), 43.7 bits, see alignment E=4.1e-15 amino acids 256 to 365 (110 residues), 75.7 bits, see alignment E=4.8e-25 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 379 to 539 (161 residues), 137.8 bits, see alignment E=1.4e-44 PF00990: GGDEF" amino acids 381 to 537 (157 residues), 124.7 bits, see alignment E=4.5e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2212)

Predicted SEED Role

"Response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXC2 at UniProt or InterPro

Protein Sequence (543 amino acids)

>Shewana3_2212 response regulator receiver modulated diguanylate cyclase (RefSeq) (Shewanella sp. ANA-3)
MSLEESLEQLKRQYLHALPDKKKQIITLWISLRKNWQSHMLSAVYREVHNLKGSCETFGL
TETKDIVDRLELQLKNLLDAPAPELPVIKGLDTLFHQLLQNNLRSEPAAPVVEAQMQQSP
YKPTKARHEYRIAIVEDDSNVGAMITKQLHEFGFNVQHFLNFTDFLGIQNTSPFDLVLLD
LILPDYTEAALFTAATEFEKNNTRVFVLSSRGDFEMRLLAIRANVSEYFVKPAETTLLVR
KIHQWLKMSEKQPLKILLVDDQQSMVDYFSSLLRSHGLMVKGMTKPEQVLPTLEQFEPDL
FIFDLYMPDVNGLELAKMIRQLDKYSSSPILVLSSDDTMQNKVSIIQAGSDDLISKQTAP
SLFVTQVISRAQRGHDIRSSASRDSLTGLLNHTQILVAARRCYNLAKRINSSVCIAMLDL
DHFKQVNDTYGHSGGDKVLLAFAHLLQQSLRPVDFMGRYGGEEFMLVLPDLPAPLAIAKL
NAIRESFSHIVFVEEGAEFKVTLSGGLAFSTECNEFQDCLLLADKNLYEAKRTGRNRLIT
TLK