Protein Info for Shewana3_2205 in Shewanella sp. ANA-3

Annotation: AraC family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF12625: Arabinose_bd" amino acids 29 to 211 (183 residues), 80.3 bits, see alignment E=3e-26 PF12833: HTH_18" amino acids 312 to 388 (77 residues), 58.8 bits, see alignment E=7.9e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2205)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXB5 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Shewana3_2205 AraC family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MRALATWQDKCIDSQLLVASIVGLFKQRGLDSDKLLRGTGIFAADIRKPDHLISPKQLSR
LLDNALCLWPSGDLSFLLGQLWLPSQSGALTAGIFCARDLQSLGHFWHKYHWLTQPWLQT
WRWQGEQEWHFLLSLDLGMQRHKQFFIELSLSSLTACCKQLLGQAWRGSISFPYPAPANL
AHYYKYFGTELSFDAPLCRISMGKSLLCQPLLFASHSETDAIDFAGSKYTKPPNKPAALQ
PWDHPHAGTWDHPQAGTLDRHFNEPLASTVLGPQLTMAKNARQALLAHGFRHGLAAGIRL
KLMHNALSLPEIAQLLEMSPATLKRRVGEMGLSYGQLVDESRLIKALYFLAEPDQDANSI
AHSLSFSDASNFRRSFKRWTGQLPAYFRFWLA