Protein Info for Shewana3_2196 in Shewanella sp. ANA-3

Annotation: PepSY-associated TM helix domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 11 to 366 (356 residues), 187.7 bits, see alignment E=2.2e-59

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2196)

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXA6 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Shewana3_2196 PepSY-associated TM helix domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MAKISNRFWFMLHGWVSLPIWILFSFICLTGTVAVLSHELTWLTNPAARATNPNELPAKP
VDELMLVVEKAYPNAQVMGAMTLEPYLVNAITFTDADKPYAIAYVNQYTGEIQQINEGLT
FIGFMRSLHGWLLFPWQSGYSVGYYLVCSMALLMLASLITGLIVYKRFWRSFFAPKLRLT
QGKKTLLSDLHKLSGVWSIWFIAIMSLTGLWYLVQAIFWHADIDIESHAPMIAAEQVPLM
QAGDTQLPSANVSFTEALSLAKQRFPDFQPSYVMLPEHQRDMYHLSGSGDHIFYDQYSYS
LSINPWTGEIASATSPETMTGMQTLMHIADPLHYGTLAGIWTKLIWFFFGLVLSGMSITG
FMMWGLRHVRAFKQAETKDLAADMIGEAR