Protein Info for Shewana3_2164 in Shewanella sp. ANA-3

Annotation: queuosine biosynthesis protein QueC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02540: NAD_synthase
  • amino acids 4 to 65 (62 residues), 23.4 bits, E=3.1e-09
• PF06508: QueC
  • amino acids 8 to 217 (210 residues), 270.2 bits, E=1.1e-84
• TIGR00364: queuosine biosynthesis protein QueC
  • amino acids 10 to 210 (201 residues), 269 bits, E=1.2e-84

Best Hits

Swiss-Prot: 100% identical to QUEC_SHESA: 7-cyano-7-deazaguanine synthase (queC) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 100% identity to shn:Shewana3_2164)

MetaCyc: 66% identical to 7-cyano-7-deazaguanine synthase (Escherichia coli K-12 substr. MG1655)
RXN-12093 [EC: 6.3.4.20]

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

• preQ₀ biosynthesis (2/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.20

Sequence Analysis Tools

See A0KX75 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Shewana3_2164 queuosine biosynthesis protein QueC (RefSeq) (Shewanella sp. ANA-3)
MSAASVSKVVVVFSGGQDSTTCLIQALTQFDEVHGITFDYGQRHREEIEVAKSLAKRLKI
TSHKVIDVSLLNELAISALTRDAIPVSHELMENGLPNTFVPGRNILFLTLAGIYAYQLGA
GAIITGVCETDFSGYPDCRHDFVRAMESALVQGMDKKLEIITPLMWLNKAQTWALADKYQ
QLDLVRHHTLTCYNGIVGDGCGACPACHLRKRGLEDYLQNKAEVMASLDKATATGKPQA