Protein Info for Shewana3_2153 in Shewanella sp. ANA-3

Annotation: pyruvate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 3 to 329 (327 residues), 402 bits, E=2e-124
• TIGR01064: pyruvate kinase
  • amino acids 3 to 478 (476 residues), 535.1 bits, E=6.5e-165
• PF02887: PK_C
  • amino acids 361 to 476 (116 residues), 107.5 bits, E=4.4e-35

Best Hits

Swiss-Prot: 72% identical to KPYK2_ECOLI: Pyruvate kinase II (pykA) from Escherichia coli (strain K12)

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 100% identity to shn:Shewana3_2153)

MetaCyc: 72% identical to pyruvate kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyruvate kinase. [EC: 2.7.1.40]

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• mixed acid fermentation (15/16 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• Bifidobacterium shunt (13/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• heterolactic fermentation (15/18 steps found)
• Rubisco shunt (9/10 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

See A0KX64 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Shewana3_2153 pyruvate kinase (RefSeq) (Shewanella sp. ANA-3)
MFRRTKIVTTLGPATDRDDNLRRIIAAGANVVRLNFSHGSPEDHLKRATQAREIAKELGV
HVAILGDLQGPKIRVSTFKDNKKVQLNLGQAYILDAELGKGEGDENQVGIDYKQLPDDVN
VGDILMLDDGRVQLRVERVEGRKVHTTVTVAGPLSNNKGINKQGGGLSAAALTEKDKADI
LTAAMIQVDYLAVSFPRSGADLEYARSLAQQAGSNALIVAKVERAEAVASEEAMDDVILA
SDVVMVARGDLGVEIGDAALVAVQKKLIARSRQLNKIVITATQMMESMISSPMPTRAEVM
DVANAVLDGTDAVMLSAETAAGDFPEETVKAMANVCIGAESHPSVKVSKHRLDARFTSVE
ETIALSTMYAANHLEGVKAIIALTESGATPKLMSRISSSLPILGLSRHETTLAKMALYRG
VLPIYFDSTIYPADELAQKALESLTAAGYLQSGDLVLMTKGDAMETIGGTNTCKVLIVA