Protein Info for Shewana3_2151 in Shewanella sp. ANA-3

Annotation: glucose-6-phosphate 1-dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 10 to 489 (480 residues), 635.1 bits, E=3.9e-195
• PF00479: G6PD_N
  • amino acids 14 to 187 (174 residues), 191.7 bits, E=2e-60
• PF02781: G6PD_C
  • amino acids 190 to 488 (299 residues), 414.6 bits, E=2e-128

Best Hits

Swiss-Prot: 65% identical to G6PD_ECOLI: Glucose-6-phosphate 1-dehydrogenase (zwf) from Escherichia coli (strain K12)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to shm:Shewmr7_1929)

MetaCyc: 65% identical to NADP+-dependent glucose-6-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glucose-6-phosphate dehydrogenase. [EC: 1.1.1.49]

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• heterolactic fermentation (15/18 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

See A0KX62 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Shewana3_2151 glucose-6-phosphate 1-dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MGKTTSGAKACDFVLFGTKGDLARRKLLPSLYQLDKAELLDKNTKVIGVAKDEFSQDEFR
ELVILALKTFVKEALCEETVQRFLSRCHYVGTNFTESAGYSAFHELLKPEERVMVSYFAT
PPAIFGDICRCLHEQNLIHSDSRVVLEKPIGSDLASSRVINDQVSAYFKENQVYRIDHYL
GKETVQNLIALRFANSLFASKWDNRTIDHVQITVAEEVGIEGRWGYFDKAGQMRDMIQNH
LLQVLTLVAMDPPVNLDADSIRDEKVKVLKSLRPINADNVYENTVRGQYSAGFLKGSPVP
GYLEEEGANLQSHTETFVALRVDIDNWRWAGVPFYLRSGKRMPFKSSEIVVYFKNPPHNL
YRSSYRNLPPNKLTIRLQPHEGVEIQMMNKVPGLEQKQRLQTTKLDLSFSDTFKNERIAD
AYERLLLEAMLGNQALFVRRDEVEQAWTWVDGIIQSWEQSNEKPKPYPAGTWGPVASVAL
ITKDGRSWDE