Protein Info for Shewana3_2136 in Shewanella sp. ANA-3

Annotation: alpha/beta hydrolase fold (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF12146: Hydrolase_4" amino acids 20 to 112 (93 residues), 27.4 bits, see alignment E=5.1e-10 PF12697: Abhydrolase_6" amino acids 20 to 255 (236 residues), 72.7 bits, see alignment E=1.8e-23 PF00561: Abhydrolase_1" amino acids 20 to 250 (231 residues), 92.2 bits, see alignment E=1.1e-29 PF00756: Esterase" amino acids 68 to 111 (44 residues), 22 bits, see alignment 3e-08

Best Hits

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to shn:Shewana3_2136)

Predicted SEED Role

"Esterase/lipase (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KX47 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Shewana3_2136 alpha/beta hydrolase fold (RefSeq) (Shewanella sp. ANA-3)
MYHSTGDSMNFASTGQGEEVLLIHGLFGNLDNLKGLGQVLEANHQVIRVDVPNHGLSEHW
QEMDYPSLAKAMVALLDELELERIHIVGHSMGGKIAMATALAYPERIISMVAADIAPVAY
QPRHDAVFAALESLPLEGHTDRRFALSHLLAGGIDEPTAQFLLKNLQRTDTGFRWKMNLT
GLKSCYPNIIGWPNENHKSQQVYNGPSLFIRGGDSNYVTAEHRDEIMRQFPAAQAKTLEG
CGHWLHAQKPAVFNRIVSEFIDKHSV