Protein Info for Shewana3_2134 in Shewanella sp. ANA-3
Annotation: phosphoglucomutase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to PGM_ECOLI: Phosphoglucomutase (pgm) from Escherichia coli (strain K12)
KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 100% identity to shn:Shewana3_2134)MetaCyc: 58% identical to phosphoglucomutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucomutase. [EC: 5.4.2.2]
Predicted SEED Role
"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)
MetaCyc Pathways
- O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
- dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
- glycogen degradation I (7/8 steps found)
- glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
- sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
- glycogen degradation II (5/6 steps found)
- UDP-α-D-glucose biosynthesis (2/2 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- D-galactose degradation I (Leloir pathway) (4/5 steps found)
- sucrose degradation II (sucrose synthase) (4/5 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- sucrose biosynthesis II (6/8 steps found)
- starch degradation V (3/4 steps found)
- GDP-α-D-glucose biosynthesis (2/3 steps found)
- trehalose degradation V (2/3 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- glucose and glucose-1-phosphate degradation (3/5 steps found)
- glucosylglycerol biosynthesis (3/5 steps found)
- starch degradation III (2/4 steps found)
- starch biosynthesis (6/10 steps found)
- chitin biosynthesis (5/9 steps found)
- colanic acid building blocks biosynthesis (6/11 steps found)
- CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
- glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
- superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
- streptomycin biosynthesis (1/18 steps found)
KEGG Metabolic Maps
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Nucleotide sugars metabolism
- Pentose phosphate pathway
- Starch and sucrose metabolism
- Streptomycin biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.4.2.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KX45 at UniProt or InterPro
Protein Sequence (550 amino acids)
>Shewana3_2134 phosphoglucomutase (RefSeq) (Shewanella sp. ANA-3) MAIHQRAGQTASQTDLVNIPKLMSHYYSIKPNVDAAEQRVTFGTSGHRGTAFQASFNQDH IWAITQAVVDYRQSVNIDGPLFLGIDTHALSYAAYVSAIEVLAANKVTVHIQQNDGFTPT PVVSHAIICANREAALSGAALSDGLIITPSHNPPQDGGIKYNPPHGGPAEGNITAWIESR ANDYLRAGLKGVNKLAYADALTSGYVHAIDLITPYVADLVNVVDMHAIAKAKLKLGVDPL GGSGIHYWAPIAKHYGIDITLVNDKVDPSFSFMSLDKDGKIRMDCSSPYAMAGLLAHKES FDLCVGNDPDYDRHGIVCPCTGLMDPNHYLAVAIDYLLTHRPEWSEQLAIGKTLVSSALI DKICTFHGKKLLEVPVGFKWFVDGLAEATIAFGGEESAGAAFLRRDGTTWCTDKDGFILV LLAAEMLAVTGKTPGQRHQELVAQFGQSFYKRIDSPISLENKAKFAKLNAETLNATMLAG EKIDAVLTHAPGNNASIGGIKVTTANGWFAARPSGTEALFKIYGESFISEQHLADIIKDA QALIDKALSA