Protein Info for Shewana3_2131 in Shewanella sp. ANA-3

Annotation: dehydrogenase, E1 component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF00676: E1_dh" amino acids 55 to 350 (296 residues), 321.5 bits, see alignment E=2.3e-100

Best Hits

Swiss-Prot: 51% identical to ODBA_CAEEL: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (bckd-1A) from Caenorhabditis elegans

KEGG orthology group: K00166, 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [EC: 1.2.4.4] (inferred from 100% identity to shn:Shewana3_2131)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.4

Use Curated BLAST to search for 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KX42 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Shewana3_2131 dehydrogenase, E1 component (RefSeq) (Shewanella sp. ANA-3)
MSKATLNTDTVHRVGFLDKASLHIPILRILQADGTTYETAVLPVIDEALATKIYDTCVFT
RVLDERMLGAQRQGRISFYMTCTGEEAAIVGSVAALDQEDVILAQYREHAALRYRGFTTE
QFMNQMFSNEKDLGKGRQMPIHYGCAALNYQTISSPLATQIPQATGVGYSLKMQGKRNVA
VCYFGEGAASEGDFHAGLNMAAVLKCPVIFFCRNNGYAISTPTEEQFAGNGIASRGVGYG
MHTIRVDGNDMLAVLAATQQARAYAIEHNAPVLIEAMTYRLGAHSSSDDPSGYRSKEEEA
KWQQHDPVKRFKLWLINKGWLAEADDAQRYEKYREEVLAAVKVAEKLPIPMLDEIIEDVY
DKPTPALKKQLSELKEHIKKYPQSYPKSAGRL