Protein Info for Shewana3_2114 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details PF13386: DsbD_2" amino acids 9 to 219 (211 residues), 202.9 bits, see alignment E=2.5e-64

Best Hits

KEGG orthology group: K09792, hypothetical protein (inferred from 100% identity to shm:Shewmr7_1962)

Predicted SEED Role

"Heavy-metal-associated domain (N-terminus) and membrane-bounded cytochrome biogenesis cycZ-like domain, possible membrane copper tolerance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KX25 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Shewana3_2114 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MIEYNVTGAFLVGLMGAAHCFGMCGGLVGAFSSQLPNPKQGNHLAHQLTYLLSYNLGRIL
SYTLAGALVGGSSAMLGHLFELDSYLLILRIIAGVMMIATGLYIAKIWVGIVQIERLGQV
LWRYLKPLAQRLVPINTPMQAITAGLIWGWLPCGLVYSTLTWSVAAGSASQGALIMFAFG
LGTLPALLSAGVAAKRLANWVQQKTVRLLSGLLLIAFGAQTLYIALSQLN