Protein Info for Shewana3_2092 in Shewanella sp. ANA-3

Annotation: formate dehydrogenase accessory protein FdhE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 149 to 168 (20 residues), see Phobius details PF04216: FdhE_N" amino acids 20 to 171 (152 residues), 116.8 bits, see alignment E=1.9e-37 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 26 to 295 (270 residues), 230.7 bits, see alignment E=1.5e-72 PF24859: FdhE_central" amino acids 180 to 217 (38 residues), 72.1 bits, see alignment 4.7e-24 PF24860: FdhE_C" amino acids 219 to 294 (76 residues), 64.7 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: K02380, FdhE protein (inferred from 100% identity to shn:Shewana3_2092)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KX03 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Shewana3_2092 formate dehydrogenase accessory protein FdhE (RefSeq) (Shewanella sp. ANA-3)
MKMASDIPLSFVDKSPLALKPLKAADPEKIYQHRARRLAQLAQDSPLADYLKLCQILVST
QQKLAATEMGPAPKIDPEVPYPLSLSQTQTAQDWLKALQALLTKLVSQVPTHLVPVLQEL
QQQSPTQLLEWGTQLRQGEFSAVPAQYSLFIWAGLSLYWSHWAPMVIARMDVNKVKQSSL
CPVCGSHPVASMIVDEPREGLRYLHCSLCESEWHYVRAHCTCCEQSREMSIWSFDDHKAA
VRIESCEACKGYTKMLFTNRLPLLDAAADDIASMGLDAELNAKGYGATTVNPLLLAHEA