Protein Info for Shewana3_2087 in Shewanella sp. ANA-3

Annotation: LysR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details PF00892: EamA" amino acids 145 to 273 (129 residues), 51 bits, see alignment E=8.6e-18

Best Hits

Swiss-Prot: 56% identical to Y1977_PSEAE: Uncharacterized protein PA1977 (PA1977) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2087)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWZ8 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Shewana3_2087 LysR family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MTVFRLFTLTTLTMFAFACNSILCRLALKDGSIDAGSFTLIRLLSGAIMLWLLSLNKPAL
EAKGHWGSALALFVYAAGFSYAYINMTASMGALLLFGAVQATMIGYGLYRKEIFNTRQWL
GLACAAAGLIFLLLPGLSAPPLMSSLLMISAGVAWGIYSIKGKGAKHPIPVSAGNFIRTV
PMALLLMLLVRDPLAVSQMGIIYALASGAIASGLGYAIWYSILPLLSSTYAATVQLSVPL
IAAVGGVLLLGEPLSLRLLLASCAILGGIALVVLSKSEPQNKS