Protein Info for Shewana3_2080 in Shewanella sp. ANA-3

Annotation: acetyl-CoA carboxylase, biotin carboxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 795 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07944: Glyco_hydro_127" amino acids 35 to 416 (382 residues), 399.4 bits, see alignment E=3.3e-123 PF20736: Glyco_hydro127M" amino acids 426 to 518 (93 residues), 91.8 bits, see alignment E=5.1e-30 PF16375: DUF4986" amino acids 555 to 630 (76 residues), 68.4 bits, see alignment E=1.4e-22 PF20620: DUF6805" amino acids 654 to 787 (134 residues), 138.1 bits, see alignment E=4.9e-44

Best Hits

KEGG orthology group: K09955, hypothetical protein (inferred from 100% identity to shn:Shewana3_2080)

Predicted SEED Role

"Putative glycosyl hydrolase of unknown function (DUF1680)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWZ1 at UniProt or InterPro

Protein Sequence (795 amino acids)

>Shewana3_2080 acetyl-CoA carboxylase, biotin carboxylase (RefSeq) (Shewanella sp. ANA-3)
MNTARLFGLCLLLPLTCPFVSQPSFASLTPIPLNDVRLTAGPFLHAQQTDLAYIMSMDPE
RLLAPYRKAAGIATTADNYPNWENTGLDGHIGGHYLSALALMYAATGDQAVLSRLNYMVA
ELEKCQQAHGNGYVGGVPHGDKLWQQVAAGHIEADLFTLNQSWVPWYNVHKVFAGLRDAY
LYTQNPTAKKMLVGFADWMLDLSRNLSDEQLQLMLRTEYGGLNETLADVYSITGQNKYLN
LANRYTDQSLLQPLLQHQDKLTGLHANTQIPKIVGVARIAELSNNKEWLESADYFWQQVV
HQRTVSIGGNSVREYFHPSEDFSSMLDSVEGPETCNTYNMLKLSKLLYENKRDLRYIDYY
ERALYNHILSSQHPQTGGLVYFTPMRPDHYRVYSSAQESMWCCVGSGIENHAKYGELIYA
EEDNNLFVNLFVDSEVHWKAKGISLSQKTQFPDDNTSQMIIHQEADFTLNLRYPTWAKGE
VTVSINGEPQRFTPTQGQYIPLTRHWRKGDSVTITLPMDISLEQLPDKSAYYSVLYGPIV
LAAKTAPIANEALNFIGDASRMGHIASGPMCEPSQAPIFISDGTRFLTDIRREPMSLLQF
TTGKAHTNQASPITLIPFFRLHDSRYTLYFGQSAPDEWQQKQQELAQKAQMEAKLMAQTL
DSVQPGEQQPESDHFFKASRSEAGLNGNRHWRHAEDWFSYQLDAKGEPRPILRLTYFGLD
AGRRFDILINDKRLAEVTLPADKGPIFYSVDYPIPADMLLDSTVPFRVKFMAKPGSIAGG
LYEVRLLKSEPSSTQ