Protein Info for Shewana3_2073 in Shewanella sp. ANA-3

Updated annotation (from data): L-arabinose ABC transporter, substrate-binding component AraU
Rationale: Specifically important for L-arabinose utilization; the gene name is from PMC2996990
Original annotation: periplasmic binding protein/LacI transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 25 to 285 (261 residues), 181.1 bits, see alignment E=4.7e-57 PF00532: Peripla_BP_1" amino acids 38 to 255 (218 residues), 67.1 bits, see alignment E=2.8e-22 PF13377: Peripla_BP_3" amino acids 159 to 246 (88 residues), 31.2 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 58% identical to YTFQ_ECOLI: ABC transporter periplasmic-binding protein YtfQ (ytfQ) from Escherichia coli (strain K12)

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 99% identity to shm:Shewmr7_1988)

MetaCyc: 58% identical to galactofuranose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Predicted L-arabinose ABC transport system, periplasmic arabinose-binding protein" in subsystem L-Arabinose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWY4 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Shewana3_2073 L-arabinose ABC transporter, substrate-binding component AraU (Shewanella sp. ANA-3)
MKHNKIITALGLWAVSATCAYATTVGFSQVGSESGWRTSFSEAVKAEAKQRGIDLKFADA
QQKQENQIKAVRSFIAQGVDAIIIAPVVETGWKPVLKEAKRAKIPVVIVDRNIKVDDDSL
FLTRIASDFSEEGRKIGQWLMDKTQGNCDIAELQGTVGATAAIDRAAGFNQVIANYPNAK
IVRSQTGEFTRAKGKEVMEGFLKAQNGQPLCAVWSHNDEMALGAVQAIKEAGLKPGKDIL
IVSVDGVPDYFKAMADGDVNATVELSPYLGGPAFDAIDAYLKGNKDQAKLISTTGDVFTQ
ETAAAEYEKRRQQ