Protein Info for Shewana3_2057 in Shewanella sp. ANA-3

Annotation: DsrH family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 TIGR03011: sulfur relay protein TusB/DsrH" amino acids 3 to 93 (91 residues), 93.1 bits, see alignment E=4.7e-31 PF04077: DsrH" amino acids 8 to 90 (83 residues), 85 bits, see alignment E=1.7e-28

Best Hits

KEGG orthology group: K07237, tRNA 2-thiouridine synthesizing protein B (inferred from 99% identity to she:Shewmr4_1970)

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWW8 at UniProt or InterPro

Protein Sequence (93 amino acids)

>Shewana3_2057 DsrH family protein (RefSeq) (Shewanella sp. ANA-3)
MILHHIQTSPSRDNALKLCLRYACKEDAILLSSDGVNALLLRQWAMALSPFKVMVLKDDV
IARGLMERLKNISQIDYNEFVAQSLQHDKVITW