Protein Info for Shewana3_2052 in Shewanella sp. ANA-3

Annotation: recombination factor protein RarA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF05496: RuvB_N" amino acids 19 to 144 (126 residues), 52.8 bits, see alignment E=2.3e-17 PF13173: AAA_14" amino acids 52 to 170 (119 residues), 28 bits, see alignment E=1.1e-09 PF00004: AAA" amino acids 52 to 159 (108 residues), 66.1 bits, see alignment E=2.5e-21 PF07728: AAA_5" amino acids 52 to 139 (88 residues), 27.9 bits, see alignment E=1.2e-09 PF16193: AAA_assoc_2" amino acids 187 to 263 (77 residues), 79.4 bits, see alignment E=1.1e-25 PF12002: MgsA_C" amino acids 264 to 430 (167 residues), 219.7 bits, see alignment E=1.2e-68

Best Hits

Swiss-Prot: 68% identical to RARA_ECO57: Replication-associated recombination protein A (rarA) from Escherichia coli O157:H7

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to shn:Shewana3_2052)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWW3 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Shewana3_2052 recombination factor protein RarA (RefSeq) (Shewanella sp. ANA-3)
MSSLSFNFAPDFRPLAARMRPRTIAEYIGQAHLLGEGQPLRQALEAGRAHSMMLWGPPGT
GKTTLAELIAHYSNAHVERISAVTSGVKDIRAAIEQAQAVAQSRGQRTLLFVDEVHRFNK
SQQDAFLPFIEDGTVIFIGATTENPSFEINNALLSRARVYLIKRLSQDEIVHIITQALTD
PERGLGQRQLVMPTDVLNKLAQLCDGDARKALNLLELMSDMVADGGSFTTEMLVQVAGHQ
VAGFDKNGDQFYDLISAVHKSIRGSAPDAALYWFCRILEGGGDPLYVARRLLAIASEDVG
NADPNAMTVALNAWDCFHRVGPAEGERAIAQAIVYLASAPKSNAVYTAFKAARALARETG
QEAVPYHLRNAPTKLMAEMGFGAEYRYAHDEPNAYASGENYFPESLQESQFYFPTERGFE
KRIKDKLAQLAQLDQASGRKRYE