Protein Info for Shewana3_2047 in Shewanella sp. ANA-3

Annotation: thioredoxin reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 8 to 301 (294 residues), 172.1 bits, see alignment E=4.6e-54 TIGR01292: thioredoxin-disulfide reductase" amino acids 8 to 313 (306 residues), 408.2 bits, see alignment E=7.6e-127 PF13738: Pyr_redox_3" amino acids 56 to 285 (230 residues), 60.1 bits, see alignment E=5.6e-20 PF00070: Pyr_redox" amino acids 148 to 224 (77 residues), 53.5 bits, see alignment E=7.3e-18

Best Hits

Swiss-Prot: 82% identical to TRXB_VIBCH: Thioredoxin reductase (trxB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 99% identity to son:SO_2303)

MetaCyc: 82% identical to thioredoxin reductase (Escherichia coli K-12 substr. MG1655)
Thioredoxin-disulfide reductase. [EC: 1.8.1.9]

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWV8 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Shewana3_2047 thioredoxin reductase (RefSeq) (Shewanella sp. ANA-3)
MSQVRHSNLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTEVENWPGDAEDL
TGPALMERMQKHAEKFDTEILFDHINEVTLTERPFRLKGDNGEYTCDALIIATGASARYL
GLESEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIAAEVHLIHRRDT
FRSEKILIDRLMDKVANGNIILHLDQTMEEVVGDAMGVTGLKMKSTKDGAITDLAVAGVF
VAIGHSPNTGIFEGQLEMNNGYLKVQSGLQGNATQTSIEGVFAAGDVMDQHYRQAITSAG
TGCMAALDAERYLDAKK