Protein Info for Shewana3_2016 in Shewanella sp. ANA-3

Annotation: two component, sigma54 specific, Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF00072: Response_reg" amino acids 6 to 113 (108 residues), 91.9 bits, see alignment E=1.1e-29 PF14532: Sigma54_activ_2" amino acids 143 to 313 (171 residues), 70.6 bits, see alignment E=5.9e-23 PF00158: Sigma54_activat" amino acids 143 to 309 (167 residues), 227.9 bits, see alignment E=2.1e-71 PF07728: AAA_5" amino acids 166 to 286 (121 residues), 26.7 bits, see alignment E=1.7e-09 PF25601: AAA_lid_14" amino acids 314 to 396 (83 residues), 75 bits, see alignment E=1.2e-24 PF02954: HTH_8" amino acids 444 to 480 (37 residues), 32.9 bits, see alignment 1.5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2016)

Predicted SEED Role

"Regulatory protein luxO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWS8 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Shewana3_2016 two component, sigma54 specific, Fis family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MNYSALLVEDSMSLGALYTEYLRAEDINVTHVHYGADALKELSNWQPDLLILDIKLPDMS
GLDILKQVQQSHPHISTIMITAHGSIDIAIDAMRSGAFDFLVKPFDAKRLSITVRNALKQ
KQLLELVTQYENSLPKGHYQGFIGDSLAMQSVYKTIDCVANSKASVFIMGESGTGKEVCA
QAIHQVGNRADKPFIALNCASIPKELIESEIFGHCKGAFTGAHNNRDGAATRADGGTLFL
DEICEMDLELQSKLLRFIQTGTFQRVGGSKEEHVDIRFISATNREPWEEVKLGHFREDLF
YRLHVIPIELPPLRARGNDVLLLAKQLLKTYSKEEGKKFIDFNPQAAAMLQAYDWPGNVR
QLQNVIRQIVVLNDASHVEPSMFPTPLKPLAQPQTKAQLQTKMQVEATKVDIDTLVQVAS
RELLSESTQEAHTHTADQQRIQPLWLTEKQTIEGAIALCDGNVPKAAALLDISPSTIYRK
RMTWEEQAERSSS