Protein Info for Shewana3_2005 in Shewanella sp. ANA-3

Annotation: WecB/TagA/CpsF family glycosyl transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 458 to 481 (24 residues), see Phobius details TIGR00696: glycosyltransferase, WecB/TagA/CpsF family" amino acids 220 to 395 (176 residues), 161.5 bits, see alignment E=1.7e-51 PF03808: Glyco_tran_WecG" amino acids 226 to 391 (166 residues), 208.9 bits, see alignment E=4.7e-66 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 450 to 649 (200 residues), 303.2 bits, see alignment E=4.1e-94 PF02397: Bac_transf" amino acids 455 to 643 (189 residues), 231 bits, see alignment E=7.4e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2005)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWR7 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Shewana3_2005 WecB/TagA/CpsF family glycosyl transferase (RefSeq) (Shewanella sp. ANA-3)
MNTQNSTQVRWSIRLFDSAIAMLALLLCSPFILVVYLYRKSQGQSVFERVYVHGGRNQIG
LWQFAYQGAGYRLPQLFNLLKGDIGLLGVEAQFAFTPLVDLPQVNRIDRVGIFSISAMQR
RMGIDFESSEKSLNIAYSSLSRYFFALLSAILNSLLTSASRSHTNQVTIFGVTMRNLSMT
GMLDMLVQQAQHPKHHLTPFSFVNADCLNKAYCDPQYHQILNQCEAVFADGIGVRMACRW
QGVDLRGNLNGTDMLPLLCERLIAANLSLYLLGGAPEVAHQAAEQLQCRFPQLKIAGTHH
GYFHEADTKQVIKKINQSGAAVLLVAMGAPKQELWLNQYQAKLTPAVGIGVGGLFDFYSN
RISRAPLWLRQIGMEWIWRLMQEPKRMWRRYIIGNPLFLYRVFKELRANASLNAKTQADV
QQTPATPQFPNLSDSGSLKRCKRIRLHLLLNRIVKRCLDILVAAIAILLLSPLLLIVALL
IRLESPGAVLFCQQRVGKWNQPFTMWKFRSMYQDAETRLASLQQANEMQGGVLFKMKQDP
RITRVGQFIRKTSIDELPQLWNVLKGEMSLVGPRPALPREVAQYSPSDRRRLEVKPGITC
IWQVSGRSDIPFDRQVELDVDYIYQQSLMADLSLLIKTIPAVIFSRGAY