Protein Info for Shewana3_2003 in Shewanella sp. ANA-3

Annotation: glycerol-3-phosphate cytidylyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01518: glycerol-3-phosphate cytidylyltransferase
  • amino acids 4 to 125 (122 residues), 165.7 bits, E=4.9e-53
• TIGR00125: cytidyltransferase-like domain
  • amino acids 4 to 67 (64 residues), 69.1 bits, E=2.9e-23
• PF01467: CTP_transf_like
  • amino acids 5 to 124 (120 residues), 81.4 bits, E=3.7e-27

Best Hits

Swiss-Prot: 57% identical to TARD_STAA8: Glycerol-3-phosphate cytidylyltransferase (tarD) from Staphylococcus aureus (strain NCTC 8325)

KEGG orthology group: K00980, glycerol-3-phosphate cytidylyltransferase [EC: 2.7.7.39] (inferred from 100% identity to shn:Shewana3_2003)

MetaCyc: 55% identical to glycerol-3-phosphate cytidylyltransferase monomer (Bacillus subtilis subtilis 168)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]

Predicted SEED Role

"Glycerol-3-phosphate cytidylyltransferase (EC 2.7.7.39)" in subsystem Rhamnose containing glycans (EC 2.7.7.39)

MetaCyc Pathways

• 1-(sn-glycero-1-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• 1-(sn-glycero-3-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• lipid A-core biosynthesis (P. gingivalis) (1/7 steps found)
• poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)
• poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (1/10 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (1/12 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (1/14 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.39

Sequence Analysis Tools

See A0KWR5 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Shewana3_2003 glycerol-3-phosphate cytidylyltransferase (RefSeq) (Shewanella sp. ANA-3)
MKTIITYGTYDLFHYGHVRLFQRLKAMGDKLIVGVSTDEFNALKGKAAFFNYQQRAEMVA
ACKYVDLVIPETHWQQKPQDIVALDIDIFGMGDDWQGKFDYLGTLCQVIYLGRTEAISTT
EIKTNLAMPHTKVALAIPQLIK