Protein Info for Shewana3_1994 in Shewanella sp. ANA-3

Annotation: outer membrane efflux protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 31 to 46 (16 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 36 to 491 (456 residues), 355.3 bits, see alignment E=2.6e-110 PF02321: OEP" amino acids 96 to 280 (185 residues), 84.4 bits, see alignment E=4.7e-28 amino acids 309 to 489 (181 residues), 117.4 bits, see alignment E=3.6e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1994)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWQ6 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Shewana3_1994 outer membrane efflux protein (RefSeq) (Shewanella sp. ANA-3)
MVKHHTLSSHPSSATRPVMQSVSVGLRLKPLYLGLVTALSVAGCAMGPDYQRPELVLPNQ
YQAQMLSQTTAEQGNVKEVSALSWRHFYQDPVLISLIEHALANNLDLQMAQSRLLAARSK
MTVVDSALWPEVSVKAGYERSLDSGATSTNPSPSTTLDLGGAVSWELDLWGANRRASEAA
MADYLSEVEKLRLTYVSLISDIASRYYEWLDIEQRYSVSIDTVGLRQKELDIAKLRHANG
VISGLDVRQAEVELQSTKVTLPTLDYERKYKINQLHILLGEYDYALPSPQGLPENMGLPY
ELNTGVPSELLTLRPDVKIAEQQMIAANAEVGIAKAAFFPKFTISGVYGRENDHLKDIFD
SNGVTWSLLGGISAPIFNRGKIAAEYDIATEAAKQSMLSYRNVVLTAYFDVNDALNNLKR
AQEAIKAQKELVESSSAYARLARLRYQNGVATSLDLMDAQRQLFSAQLAYSEILRDKQLA
KIALYRALGGGAVSE