Protein Info for Shewana3_1989 in Shewanella sp. ANA-3

Name: emrD
Annotation: multidrug resistance protein D (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 366 (338 residues), 130.7 bits, see alignment E=6.4e-42 PF00083: Sugar_tr" amino acids 58 to 129 (72 residues), 26.4 bits, see alignment E=3.4e-10

Best Hits

KEGG orthology group: K08154, MFS transporter, DHA1 family, 2-module integral membrane pump EmrD (inferred from 100% identity to shn:Shewana3_1989)

Predicted SEED Role

"Multidrug resistance protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWQ1 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Shewana3_1989 multidrug resistance protein D (RefSeq) (Shewanella sp. ANA-3)
MMSDDAPSLISQKAPTPAAGSATQLLFMLVFMVACGQMAQTIFVPALPLIAQGLAVDASK
LQAVMACYLLAYGLCQFIYGPLSDRVGRKMPLLIGIGIFILGALMAAEATSFNQLIFASL
LQGLGTASAGALCRSIPRDHYFGDNLVRFNSYVSMAVVFLPLVAPFLGSFASAYWGVQAV
YWVLFGFGSLVWLLLCFGFKESLPKHKREQQPILASYRHVLRHRSFRAYLLSLIATFAGI
AAFEAIAGVLYGQYLQLSPFMVSCYFVAPIPGYLLGALIAGRQKQAQRTVLQGVALLGAG
ALFMLIPGIFQLVVGWSLLIGSILFFSGAGMLFPTLTSAALEPFPRQAGIAGALLGGLQN
FGAGLAALTMSLVPMGGQLSIGLLSALMVLLVIVALHYARDQNDTHHTLLPQNP