Protein Info for Shewana3_1970 in Shewanella sp. ANA-3

Annotation: HAD family hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 175 to 193 (19 residues), see Phobius details PF00702: Hydrolase" amino acids 6 to 182 (177 residues), 78.9 bits, see alignment E=1.4e-25 PF13419: HAD_2" amino acids 9 to 183 (175 residues), 98.4 bits, see alignment E=1.1e-31

Best Hits

Swiss-Prot: 40% identical to GPH_XANCP: Phosphoglycolate phosphatase (gph) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to shn:Shewana3_1970)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ubiquinone biosynthesis SAM-dependent O-methyltransferase" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWN2 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Shewana3_1970 HAD family hydrolase (RefSeq) (Shewanella sp. ANA-3)
MSLAEVKGVLFDLDGTLADTAPDLVQALNLSLSDVGIAAKPLADMRSAASHGSFALVDAA
IPGADDALRTQVQQGLLAHYQRINGDHCQLFDGIAPLLDWLELCRVPFGVITNKPARFTR
PLLHKLKLSSRMPVMISGDSTRYPKPHTAPMLLGAQQLQCLPQQILYLGDAERDLLAAQA
AGMLGVIALWGYLGEADTPDAWPAYAQFTSPSSLHSALSQALAK